RNF21 (TRIM34) Rabbit Polyclonal Antibody

SKU TA345334

Rabbit Polyclonal Anti-TRIM34 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM34 antibody: synthetic peptide directed towards the N terminal of human TRIM34. Synthetic peptide located within the following region: CRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHLANIVERLKEV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: tripartite motif containing 34
• Database Link:
  NP_569074
  Q9BYJ4
• Background: TRIM34 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Expression of this gene is up-regulated by interferon. This gene is mappped
• Synonyms: IFP1; RNF21
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome