ZNF71 Rabbit Polyclonal Antibody

SKU TA345331

Rabbit Polyclonal Anti-ZNF71 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF71 antibody: synthetic peptide directed towards the middle region of human ZNF71. Synthetic peptide located within the following region: RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: zinc finger protein 71
• Database Link:
  NP_067039
  Q9NQZ8
• Background: ZNF71 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
• Synonyms: EZFIT
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors