ZNF307 (ZKSCAN4) Rabbit Polyclonal Antibody

SKU TA345269

Rabbit Polyclonal Anti-ZNF307 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF307 antibody: synthetic peptide directed towards the C terminal of human ZNF307. Synthetic peptide located within the following region: FTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: zinc finger with KRAB and SCAN domains 4
• Database Link:
  NP_061983
  Q969J2
• Background: ZNF307 contains 1 SCAN box domain, 1 KRAB domain and 7 C2H2-type zinc fingers. It belongs to the Krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
• Synonyms: P1P373C6; ZNF307; ZNF427; ZSCAN36
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Pig: 92%; Bovine: 92%; Dog: 86%; Mouse: 86%; Rabbit: 79%

Reference Data

• Protein Families: Transcription Factors