ZNF444 Rabbit Polyclonal Antibody

SKU TA345248

Rabbit Polyclonal Anti-ZNF444 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF444 antibody: synthetic peptide directed towards the C terminal of human ZNF444. Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: zinc finger protein 444
• Database Link:
  NP_060807
  Q8N0Y2
• Background: ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, which strongly suggested that ZNF444 is a transcriptional regulator.ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534). [supplied by OMIM]
• Synonyms: EZF-2; EZF2; ZSCAN17
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors