ZNF280C Rabbit Polyclonal Antibody

SKU TA345225

Rabbit Polyclonal Anti-ZNF280C Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF280C antibody: synthetic peptide directed towards the N terminal of human ZNF280C. Synthetic peptide located within the following region: DDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDEDDDELIFVGEI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 83 kDa
• Gene Name: zinc finger protein 280C
• Database Link:
  NP_060136
  Q8ND82
• Background: ZNF280C contains 5 C2H2-type zinc fingers. It may function as a transcription factor.
• Synonyms: SUHW3; ZNF633
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Dog: 83%; Pig: 79%; Horse: 79%

Reference Data