Enkephalin (PENK) Rabbit Polyclonal Antibody

SKU TA345157

Rabbit Polyclonal Anti-PENK Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: proenkephalin
• Database Link:
  NP_006202
  P01210
• Background: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK(114-133) and PENK(237-258) increase glutamate release in the striatum. PENK(114-133) decreases GABA concentration in the striatum.
• Synonyms: enkephalin A; preproenkephalin; proenkephalin
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein