PFDN2 Rabbit Polyclonal Antibody

CAT#: TA345121

Rabbit Polyclonal Anti-PFDN2 Antibody - middle region

Product Images

WB Suggested Anti-PFDN2 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PFDN2 antibody: synthetic peptide directed towards the middle region of human PFDN2. Synthetic peptide located within the following region: LTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: prefoldin subunit 2
• Database Link:
  NP_036526
  Entrez Gene 5202 Human
  UniProt ID Q9UHV9
• Background: This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008]
• Synonyms: PFD2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%