C22orf28 (RTCB) Rabbit Polyclonal Antibody

SKU TA345114

Rabbit Polyclonal Anti-C22orf28 Antibody - N-terminal region

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C22orf28 antibody: synthetic peptide directed towards the N terminal of human C22orf28. Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: RNA 2',3'-cyclic phosphate and 5'-OH ligase
• Database Link:
  NP_055121
  Q9Y3I0
• Background: The function of this protein remains unknown.
• Synonyms: C22orf28; DJ149A16.6; FAAP; HSPC117
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data