BRP44L (MPC1) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Rat |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Mpc1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mpc1. Synthetic peptide located within the following region: GALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIIS |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 11 kDa |
Gene Name | mitochondrial pyruvate carrier 1 |
Database Link | |
Background | may be involved in apoptosis of neuronal cells [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: AF304429.1, BC097287.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS388403, SRS388410 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END## |
Synonyms | BRP44L; CGI-129; dJ68L15.3; MPYCD |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Yeast: 90% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.