BRP44L (MPC1) Rabbit Polyclonal Antibody

SKU TA345066

Rabbit Polyclonal Anti-MPC1 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Mpc1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mpc1. Synthetic peptide located within the following region: GALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIIS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 11 kDa
• Gene Name: mitochondrial pyruvate carrier 1
• Database Link:
  NP_057182
  Q9Y5U8
• Background: may be involved in apoptosis of neuronal cells [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: AF304429.1, BC097287.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS388403, SRS388410 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END##
• Synonyms: BRP44L; CGI-129; dJ68L15.3; MPYCD
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Yeast: 90%

Reference Data