HSD17B14 Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HSD17B14 antibody: synthetic peptide directed towards the N terminal of human HSD17B14. Synthetic peptide located within the following region: RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 28 kDa |
Gene Name | hydroxysteroid (17-beta) dehydrogenase 14 |
Database Link | |
Background | 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]). [supplied by OMIM, Jun 2009]. ##Evidence-Data-START## Transcript exon combination :: AF126781.1, BC006283.2 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## |
Synonyms | DHRS10; retSDR3; SDR47C1 |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Pig: 85%; Rat: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review