C15orf15 (RSL24D1) Rabbit Polyclonal Antibody

SKU TA345037

Rabbit Polyclonal Anti-C15orf15 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C15orf15 antibody: synthetic peptide directed towards the middle region of human C15orf15. Synthetic peptide located within the following region: KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: ribosomal L24 domain containing 1
• Database Link:
  NP_057388
  Q9UHA3
• Background: The function of this protein remains unknown.
• Synonyms: C15orf15; HRP-L30-iso; L30; RLP24; RPL24; RPL24L; TVAS3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 83%; Yeast: 75%

Reference Data

• Protein Pathways: Ribosome