PEX5 related protein (PEX5L) Rabbit Polyclonal Antibody

SKU
TA345010
Rabbit Polyclonal Anti-PEX5L Antibody - C-terminal region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Pex2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 68 kDa
Gene Name peroxisomal biogenesis factor 5-like
Database Link
Background The function remains unknown.
Synonyms PEX5R; PEX5RP; PXR2; PXR2B; TRIP8b
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%
Reference Data
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PEX5 related protein (PEX5L) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.