CHCHD8 (COA4) Rabbit Polyclonal Antibody

SKU TA345008

Rabbit Polyclonal Anti-CHCHD8 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHCHD8 antibody: synthetic peptide directed towards the middle region of human CHCHD8. Synthetic peptide located within the following region: SHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 10 kDa
• Gene Name: cytochrome c oxidase assembly factor 4 homolog
• Database Link:
  NP_057649
  Q9NYJ1
• Background: The function of CHCHD8 remains unknown.
• Synonyms: CHCHD8; CMC3; E2IG2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 83%; Horse: 79%; Mouse: 79%

Reference Data