FAM29A (HAUS6) Rabbit Polyclonal Antibody

SKU
TA344982
Rabbit Polyclonal Anti-FAM29A Antibody - middle region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FAM29A antibody: synthetic peptide directed towards the middle region of human FAM29A. Synthetic peptide located within the following region: RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 108 kDa
Gene Name HAUS augmin like complex subunit 6
Database Link
Background FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.
Synonyms Dgt6; FAM29A
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Horse: 79%
Reference Data
Write Your Own Review
You're reviewing:FAM29A (HAUS6) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.