ARL8B Rabbit Polyclonal Antibody

SKU TA344917

Rabbit Polyclonal Anti-ARL8B Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARL8B antibody: synthetic peptide directed towards the middle region of human ARL8B. Synthetic peptide located within the following region: SRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDRE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 21 kDa
• Gene Name: ADP ribosylation factor like GTPase 8B
• Database Link:
  NP_060654
  Q9NVJ2
• Background: ARL8B may play a role in lysosome motility and chromosome segregation.
• Synonyms: ARL10C; Gie1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data