CNDP2 Rabbit Polyclonal Antibody

SKU TA344899

Rabbit Polyclonal Anti-CNDP2 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNDP2 antibody: synthetic peptide directed towards the middle region of human CNDP2. Synthetic peptide located within the following region: ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: CNDP dipeptidase 2 (metallopeptidase M20 family)
• Database Link:
  NP_060705
  Q96KP4
• Background: CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).
• Synonyms: CN2; CPGL; HEL-S-13; HsT2298; PEPA
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 86%; Horse: 86%; Rabbit: 86%; Bovine: 79%; Zebrafish: 77%

Reference Data

• Protein Families: Protease