UEVLD Rabbit Polyclonal Antibody

SKU
TA344884
Rabbit Polyclonal Anti-UEVLD Antibody - middle region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-UEVLD antibody: synthetic peptide directed towards the middle region of human UEVLD. Synthetic peptide located within the following region: SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 42 kDa
Gene Name UEV and lactate/malate dehyrogenase domains
Database Link
Background UEVLD is a possible negative regulator of polyubiquitination.
Synonyms ATTP; UEV3
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Rabbit: 93%; Pig: 92%; Horse: 92%; Bovine: 92%; Mouse: 91%; Guinea pig: 86%; Dog: 85%
Reference Data
Write Your Own Review
You're reviewing:UEVLD Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.