TCP11L1 Rabbit Polyclonal Antibody

SKU TA344863

Rabbit Polyclonal Anti-TCP11L1 Antibody - C-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TCP11L1 antibody is: synthetic peptide directed towards the C-terminal region of Human TCP11L1. Synthetic peptide located within the following region: GQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 65 kDa
• Gene Name: t-complex 11 like 1
• Database Link:
  NP_060863
  Q9NUJ3
• Background: The function of this protein remains unknown.
• Synonyms: dJ85M6.3
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Rabbit: 92%; Dog: 79%

Reference Data