LRDD (PIDD1) Rabbit Polyclonal Antibody

SKU TA344851

Rabbit Polyclonal Anti-LRDD Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRDD antibody: synthetic peptide directed towards the N terminal of human LRDD. Synthetic peptide located within the following region: RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 83 kDa
• Gene Name: p53-induced death domain protein 1
• Database Link:
  NP_060964
  Q9HB75
• Background: The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-c
• Synonyms: DKFZp434D229; leucine-rich and death domain containing; leucine-rich repeats and death domain containing; leucine rich repeat and death domain containing protein; MGC16925; PIDD
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: p53 signaling pathway