ACTR3B Rabbit Polyclonal Antibody

SKU TA344776

Rabbit Polyclonal Anti-ACTR3B Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACTR3B antibody: synthetic peptide directed towards the N terminal of human ACTR3B. Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: ARP3 actin-related protein 3 homolog B (yeast)
• Database Link:
  NP_065178
  Q9P1U1
• Background: ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.
• Synonyms: ARP3BETA; ARP11
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data