PLEKHA1 Rabbit Polyclonal Antibody

SKU TA344723

Rabbit Polyclonal Anti-PLEKHA1 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLEKHA1 antibody: synthetic peptide directed towards the N terminal of human PLEKHA1. Synthetic peptide located within the following region: LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: pleckstrin homology domain containing A1
• Database Link:
  NP_067635
  Q9HB21
• Background: PLEKHA1 binds specifically to phosphatidylinositol-3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. PLEKHA1 may recruit other proteins to the plasma membrane.
• Synonyms: TAPP1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 86%

Reference Data