LHPP Rabbit Polyclonal Antibody

CAT#: TA344694

Rabbit Polyclonal Anti-LHPP Antibody - C-terminal region


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP), 20 µg
    • 20 ug

USD 867.00

Other products for "LHPP"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Lhpp antibody is: synthetic peptide directed towards the C-terminal region of Lhpp. Synthetic peptide located within the following region: VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name phospholysine phosphohistidine inorganic pyrophosphate phosphatase
Background Lhpp is a phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. It has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency.
Synonyms HDHD2B
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Oxidative phosphorylation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.