MRPS33 Rabbit Polyclonal Antibody

SKU TA344642

Rabbit Polyclonal Anti-MRPS33 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mrps33 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DWYPNHNTYFALMGNLRFLGLYRDEHQDFKDEQRRLKKLRGKGKPRKGEG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 12 kDa
• Gene Name: mitochondrial ribosomal protein S33
• Database Link:
  NP_057155
  Q9Y291
• Background: The function of this protein remains unknown.
• Synonyms: CGI-139; MRP-S33; PTD003; S33mt
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 92%; Bovine: 83%

Reference Data