PPP2R2C Rabbit Polyclonal Antibody

SKU TA344602

Rabbit Polyclonal Anti-PPP2R2C Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ppp2r2c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: protein phosphatase 2 regulatory subunit Bgamma
• Database Link:
  NP_065149
  Q9Y2T4
• Background: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
• Synonyms: B55-GAMMA; IMYPNO; IMYPNO1; PR52; PR55G
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Tight junction