THEG Rabbit Polyclonal Antibody

SKU TA344590

Rabbit Polyclonal Anti-THEG Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-THEG antibody: synthetic peptide directed towards the middle region of human THEG. Synthetic peptide located within the following region: DRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: theg spermatid protein
• Database Link:
  NP_954672
  Q9P2T0
• Background: This gene is specifically expressed in the nucleus of haploid male germ cells. It encodes a protein that may be involved in the regulation of germ cell nuclear functions. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Synonyms: CT56; THEG1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 85%

Reference Data