TATA Element Modulatory Factor 1 (TMF1) Rabbit Polyclonal Antibody

SKU TA344464

Rabbit Polyclonal Anti-TMF1 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMF1 antibody: synthetic peptide directed towards the N terminal of human TMF1. Synthetic peptide located within the following region: TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 123 kDa
• Gene Name: TATA element modulatory factor 1
• Database Link:
  NP_009045
  P82094
• Background: TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).
• Synonyms: ARA160; TMF
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 86%; Bovine: 86%; Rat: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transcription Factors