RBFOX1 Rabbit Polyclonal Antibody

SKU
TA344419
Rabbit Polyclonal Anti-A2BP1 Antibody - N-terminal region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-A2BP1 antibody is: synthetic peptide directed towards the N-terminal region of Human A2BP1. Synthetic peptide located within the following region: NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 40 kDa
Gene Name RNA binding protein, fox-1 homolog 1
Database Link
Background Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.
Synonyms 2BP1; A2BP1; FOX-1; FOX1; HRNBP1
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Bovine: 100%
Reference Data
Write Your Own Review
You're reviewing:RBFOX1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.