BPGM Rabbit Polyclonal Antibody

SKU
TA344413
Rabbit Polyclonal Anti-BPGM Antibody - middle region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BPGM antibody: synthetic peptide directed towards the middle region of human BPGM. Synthetic peptide located within the following region: EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 28 kDa
Gene Name bisphosphoglycerate mutase
Database Link
Background BPGM belongs to the phosphoglycerate mutase family, BPG-dependent PGAM subfamily. It plays a major role in regulating hemoglobin oxygen affinity as a consequence of controlling 2,3-BPG concentration. It can also catalyze the reaction of EC 5.4.2.1 (mutase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
Synonyms DPGM
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Bovine: 93%; Zebrafish: 92%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%; Mouse: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways
Write Your Own Review
You're reviewing:BPGM Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.