TFPI2 Rabbit Polyclonal Antibody

SKU TA344403

Rabbit Polyclonal Anti-TFPI2 Antibody - middle region

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFPI2 antibody: synthetic peptide directed towards the middle region of human TFPI2. Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: tissue factor pathway inhibitor 2
• Database Link:
  NP_006519
  P48307
• Background: TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.
• Synonyms: PP5; REF1; TFPI-2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein