HIRIP3 Rabbit Polyclonal Antibody

SKU TA344388

Rabbit Polyclonal Anti-HIRIP3 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HIRIP3 antibody: synthetic peptide directed towards the middle region of human HIRIP3. Synthetic peptide located within the following region: RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 61 kDa
• Gene Name: HIRA interacting protein 3
• Database Link:
  NP_003600
  Q9BW71
• Background: The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of
• Synonyms: HIRA-interacting protein 3; HIRA interacting protein 3
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Bovine: 86%

Reference Data