SPFH2 (ERLIN2) Rabbit Polyclonal Antibody

SKU TA344331

Rabbit Polyclonal Anti-ERLIN2 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERLIN2 antibody: synthetic peptide directed towards the middle region of human ERLIN2. Synthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: ER lipid raft associated 2
• Database Link:
  NP_009106
  O94905
• Background: ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.
• Synonyms: C8orf2; Erlin-2; NET32; SPFH2; SPG18
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 86%; Pig: 79%

Reference Data