CEP70 Rabbit Polyclonal Antibody

SKU TA344267

Rabbit Polyclonal Anti-CEP70 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CEP70 antibody is: synthetic peptide directed towards the N-terminal region of Human CEP70. Synthetic peptide located within the following region: MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: centrosomal protein 70
• Database Link:
  NP_077817
  Q8NHQ1
• Background: CEP70 plays a role in the organization of both preexisting and nascent microtubules in interphase cells. During mitosis, it is required for the organization and orientation of the mitotic spindle.
• Synonyms: BITE
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data