Dematin (DMTN) Rabbit Polyclonal Antibody

SKU TA344235

Rabbit Polyclonal Anti-DMTN Antibody - C-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DMTN antibody is: synthetic peptide directed towards the C-terminal region of Human DMTN. Synthetic peptide located within the following region: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: dematin actin binding protein
• Database Link:
  NP_001969
  Q08495
• Background: Dematin, or EPB49, is an actin-bundling protein originally identified in the erythroid membrane skeleton. Its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase and is restored after dephosphorylation.
• Synonyms: DMT; EPB49
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 93%; Rabbit: 92%; Zebrafish: 85%

Reference Data