KRT75 Rabbit Polyclonal Antibody

SKU TA344209

Rabbit Polyclonal Anti-KRT75 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KRT75 antibody: synthetic peptide directed towards the middle region of human KRT75. Synthetic peptide located within the following region: SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: keratin 75
• Database Link:
  NP_004684
  O95678
• Background: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion
• Synonyms: K6HF; KB18; PFB
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 79%

Reference Data