Cxxc5 Rabbit Polyclonal Antibody

SKU TA344201

Rabbit Polyclonal Anti-CXXC5 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Cxxc5 antibody is synthetic peptide directed towards the N-terminal region of Mouse Cxxc5. Synthetic peptide located within the following region: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: CXXC finger 5
• Database Link:
  NP_598448
  Q91WA4
• Background: Cxxc5 may indirectly participate in activation of the NF-kappa-B and MAPK pathways. It acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. Cxxc5 is also required for DNA damage-induced ATM phosphorylation, p53 activation and cell cycle arrest and is involved in myelopoiesis.
• Synonyms: CF5; HSPC195; RINF
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 79%

Reference Data