GNL3L Rabbit Polyclonal Antibody

SKU TA344198

Rabbit Polyclonal Anti-GNL3L Antibody - N-terminal region

Product Data

• Application: IF, WB
• Recommended Dilution: WB, IF
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GNL3L antibody: synthetic peptide directed towards the N terminal of human GNL3L. Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 65 kDa
• Gene Name: G protein nucleolar 3 like
• Database Link:
  NP_061940
  Q9NVN8
• Background: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.
• Synonyms: GNL3B
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Dog: 86%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Families: Protease