Slap (SLA) Rabbit Polyclonal Antibody

SKU TA344196

Rabbit Polyclonal Anti-SLAIN2 Antibody - C-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLAIN2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLAIN2. Synthetic peptide located within the following region: VPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQEITQLTQTTSSPGP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: Src-like-adaptor
• Database Link:
  NP_001039022
  Q13239
• Background: The function of this protein remains unknown.
• Synonyms: SLA1; SLAP
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Mouse: 86%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome