JARID2 Rabbit Polyclonal Antibody

SKU TA344184

Rabbit Polyclonal Anti-JARID2 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-JARID2 antibody: synthetic peptide directed towards the N terminal of human JARID2. Synthetic peptide located within the following region: THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 139 kDa
• Gene Name: jumonji and AT-rich interaction domain containing 2
• Database Link:
  NP_004964
  Q92833
• Background: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a
• Synonyms: JMJ
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Families: Transcription Factors