LGALS14 Rabbit Polyclonal Antibody

SKU TA344165

Rabbit Polyclonal Anti-LGALS14 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LGALS14 antibody: synthetic peptide directed towards the N terminal of human LGALS14. Synthetic peptide located within the following region: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 16 kDa
• Gene Name: galectin 14
• Database Link:
  NP_064514
  Q8TCE9
• Background: This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternativel
• Synonyms: CLC2; PPL13
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane