TBC1D16 Rabbit Polyclonal Antibody

SKU TA344160

Rabbit Polyclonal Anti-TBC1D16 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBC1D16 antibody: synthetic peptide directed towards the N terminal of human TBC1D16. Synthetic peptide located within the following region: EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 86 kDa
• Gene Name: TBC1 domain family member 16
• Database Link:
  NP_061893
  Q8TBP0
• Background: TBC1D16 may act as a GTPase-activating protein for Rab family protein(s).
• Synonyms: FLJ20748; MGC25062
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data