NELF (NSMF) Rabbit Polyclonal Antibody

SKU TA344116

Rabbit Polyclonal Anti-NELF Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NELF antibody: synthetic peptide directed towards the N terminal of human NELF. Synthetic peptide located within the following region: GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: NMDA receptor synaptonuclear signaling and neuronal migration factor
• Database Link:
  NP_056352
  Q6X4W1
• Background: NELF influences outgrowth of olfactory axons and migration of LHRH neurons.
• Synonyms: HH9; NELF
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 79%

Reference Data

• Protein Families: Druggable Genome