NKD2 Rabbit Polyclonal Antibody

SKU TA344088

Rabbit Polyclonal Anti-NKD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NKD2 antibody: synthetic peptide directed towards the N terminal of human NKD2. Synthetic peptide located within the following region: ARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGER
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: naked cuticle homolog 2
• Database Link:
  NP_149111
  Q969F2
• Background: In the mouse, Nkd is a Dishevelled-binding protein that functions as a negative regulator of the Wnt-beta-catenin-Tcf signaling pathway.
• Synonyms: Naked2
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 92%; Horse: 90%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Wnt signaling pathway