Wnt10a Rabbit Polyclonal Antibody

SKU TA344080

Rabbit Polyclonal Anti-Wnt10a Antibody

Product Data

• Application: IHC
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Wnt10a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RDQRWNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: wingless-type MMTV integration site family, member 10A
• Database Link:
  NP_033544
  P70701
• Background: Wnt10a is the ligand for members of the frizzled family of seven transmembrane receptors. Wnt10a is a probable developmental protein. Wnt10a may be a signaling molecule important in CNS development. Wnt10a is likely to signal over only few cell diameters.
• Synonyms: FLJ14301; SSPS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data