GIPC (GIPC2) Rabbit Polyclonal Antibody

SKU TA344075

Rabbit Polyclonal Anti-GIPC2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GIPC2 antibody: synthetic peptide directed towards the N terminal of human GIPC2. Synthetic peptide located within the following region: MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: GIPC PDZ domain containing family member 2
• Database Link:
  NP_060125
  Q8TF65
• Background: GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion.
• Synonyms: SEMCAP-2; SEMCAP2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%

Reference Data