SR140 (U2SURP) Rabbit Polyclonal Antibody

CAT#: TA344056

Reviews ()
Write a review

Rabbit Polyclonal Anti-SR140 Antibody



Get 29% off western blot control. View details.

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SR140 antibody: synthetic peptide directed towards the N terminal of human SR140. Synthetic peptide located within the following region: NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 118 kDa
Gene Name U2 snRNP associated SURP domain containing
Background The specific function of SR140 is not yet known.
Synonyms fSAPa; SR140
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%; Yeast: 83%; Goat: 80%
Reference Data
Protein Pathways Spliceosome
Other products for "U2SURP"
Frequently bought together (2)
Transient overexpression lysate of U2-associated SR140 protein (SR140)
    • 100 ug

USD 550.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies