SR140 (U2SURP) Rabbit Polyclonal Antibody

SKU TA344056

Rabbit Polyclonal Anti-SR140 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SR140 antibody: synthetic peptide directed towards the N terminal of human SR140. Synthetic peptide located within the following region: NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 118 kDa
• Gene Name: U2 snRNP associated SURP domain containing
• Database Link:
  NP_001073884
  O15042
• Background: The specific function of SR140 is not yet known.
• Synonyms: fSAPa; SR140
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%; Yeast: 83%; Goat: 80%

Reference Data

• Protein Pathways: Spliceosome