splicing factor 1 (SF1) Rabbit Polyclonal Antibody

SKU TA344047

Rabbit Polyclonal Anti-SF1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SF1 antibody: synthetic peptide directed towards the N terminal of human SF1. Synthetic peptide located within the following region: NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: splicing factor 1
• Database Link:
  NP_004621
  Q15637
• Background: SF1 contains 1 KH domain and 1 CCHC-type zinc finger. It is necessary for the ATP-dependent first step of spliceosome assembly and binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. It may act as transcription repressor.
• Synonyms: BBP; D11S636; MBBP; ZCCHC25; ZFM1; ZNF162
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors