neurobeachin like 1 (NBEAL1) Rabbit Polyclonal Antibody

SKU TA344040

Rabbit Polyclonal Anti-NBEAL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NBEAL1 antibody: synthetic peptide directed towards the N terminal of human NBEAL1. Synthetic peptide located within the following region: KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 153 kDa
• Gene Name: neurobeachin like 1
• Database Link:
  NP_945183
  Q6ZS30
• Background: NBEAL1 belongs to the WD repeat neurobeachin family. It contains 1 BEACH domain and 2 WD repeats. NBEAL1 is highly expressed in brain, kidney, prostate and testis and weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. It may be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast.
• Synonyms: A530083I02Rik; ALS2CR16; ALS2CR17; FLJ22838; FLJ26555; MGC164581; MGC168834
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 77%; Guinea pig: 77%

Reference Data