PABPC5 Rabbit Polyclonal Antibody

SKU TA343974

Rabbit Polyclonal Anti-PABPC5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PABPC5 antibody: synthetic peptide directed towards the N terminal of human PABPC5. Synthetic peptide located within the following region: DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: poly(A) binding protein cytoplasmic 5
• Database Link:
  NP_543022
  Q96DU9
• Background: PABPC5 binds the poly(A) tail of mRNA. PABPC5 may be involved in cytoplasmic regulatory processes of mRNA metabolism. PABPC5 can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.
• Synonyms: PABP5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data