NXF5 Rabbit Polyclonal Antibody

SKU TA343957

Rabbit Polyclonal Anti-NXF5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NXF5 antibody: synthetic peptide directed towards the C terminal of human NXF5. Synthetic peptide located within the following region: FTPVDFHYIRNRACFFVQVASAASALKDVSYKIYDDENQKICIFVSHFTA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: nuclear RNA export factor 5
• Database Link:
  NP_116564
  Q9H1B4
• Background: NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.
• Synonyms: TAPL-1; TAPL1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Bovine: 86%; Rabbit: 79%

Reference Data